Ravi bio assignment 2

Hi, I am Dhivya, [login to view URL] degree holder in Biotechnology and working as a Research Analyst in an MNC company. I have 2 years of experience in Research & Development (R&D), Quality control, and Quality analysis. I have experience in Bio Informatics tools and I can help you to explore more in the study and research more about this topic. Thanks Dhivya

Hi I am Msc in Biotechnology/bioinformatics and Bsc in Microbiology from Indian Institute of technology Bombay, I have tremendous experience in cell biology, genetics,immunology, plant and animal biology , mirobiology, Biophysics , biostatistics and analytical biochemistry,Bioinforamatics, metabolomics proteomics,NGS ,dat analysis using R, I have high expertise in bioinformatics field.: phylogenetic analysis, Clusterin clustalW, structural and functional bioinformatics , K means, Hierarchial clustering to find the differential expressed clusters. I have stood in below 100 ranks in 5 top national level examinations in my country in life sciences. I have 7 years experience in biology subjects. I have a publication on the diagnosis of oral cancers using Raman spectroscopy and PC-LDA modelling. I have done several projects in multivariated data analysis, Microarray data analysis. Hypothesis testing of clinical data,Pharmacovigilace and translational medicine. I have very good analytical and critical thinking skills which would be useful in any course. I can finish this in less than a month. Feel free to contact.

Hi, this is samuel and bioinformatician by profession.I am currently working in NGS data analysis in india.I can deliver ur project in 1 day of time,infact i have started working on it. a)1) MTGKDSVILRPWDFRRMEQRTKNWDRDIACFWEQHMLSCTKRLQIGSD Frame1 which has the longest transcript 2) protein-coding sequence of gene is made up entirely of 3 letter words. In the sequence, each 3 letter word is a codon, specifying a single amino acid in a protein. Split the seq AGG·TGA·CAC·CGC·AAG·CCT·TAT·ATT·AGC A·GGT·GAC·ACC·GCA·AGC·CTT·ATA·TTA·GC AG·GTG·ACA·CCG·CAA·GCC·TTA·TAT·TAG·C same for negitive strand so we have 6 reading frames. 2.a - T G C G C A T G G A T T C T G A G C G A - 0 -2 -4 -6 -8 -10 -12 -14 -16 -18 -20 -22 -24 -26 -28 -30 -32 -34 -36 -38 -40 C -2 -1 -3 -3 -5 -7 -9 -11 -13 -15 -17 -19 -21 -23 -25 -27 -29 -31 -33 -35 -37 T -4 -1 -2 -4 -4 -6 -8 -8 -10 -12 -14 -16 -18 -20 -22 -24 -26 -28 -30 -32 -34 G -6 -3 0 -2 -3 -5 -7 -9 -7 -9 -11 -13 -15 -17 -19 -21 -23 -25 -27 -29 -31 C -8 -5 -2 1 -1 -2 -4 -6 -8 -8 -10 -12 -14 -14 -16 -18 -20 -22 -24 -26 -28 G -10 -7 -4 -1 2 0 -2 -4 -5 -7 -9 -11 -13 -15 -15 -15 -17 -19 -21 -23 -25 C -12 -9 -6 -3 0 3 1 -1 -3 -5 -7 -9 -11 -12 -14 -16 -16 -18 -18 -20 -22 C -14 -11 -8 -5 -2 1 2 0 -2 -4 -6 -8 -10 -10 -12 -14 -16 -17 -17 -19 -21 A -16 -13 -10 -7 -4 -1 2 1 -1 -3 -3 -5 -7 -9 -11 -13 -13 -15 -17 -18 -18 T -18 -15 -12 -9 -6 -3 0 3 1 -1 -3 -2 -4 -6 -8 -10 -12 -14 -16 -18 -19 T -20 -17 -14 -11 -8 -5 -2 1 2 0 -2 -2 -1 -3 -5 -7 -9 -11 -13 -15

Hi Abhishek Sir I HAVE GONE THROUGH THE FILE AND I CAN DO THIS I am a doctor by profession and I have studied biotechnology as well. I have experience of doing such kind of job and can assure you top quality, accurate and plagiarism free work. Let's talk to the professional and get the top rated work. Looking forward for your message to discuss. Regards, Dr. Zubair Let's Discuss :)

A proposal has not yet been provided

The requirements are clearly indicated in the .pdf file. So no confusion. Only question is that on page 4 list of 10 topics are given and asked to choose one. It will be helpful if you can select and inform one for preparation of the presentation? Rest of the things are cool. I assure within 5 days your work will be done if I win the bid...! I am well acquainted with teaching (Biotechnology and Bioinformatics) and also handling Mol. bio projects. My experience in the wet and dry lab is vast with four successful years in the handling lab equipments, molecular bio. & successfully completed two pilot projects. All these experience will surely help in completing your project.

I have a Ph.D in Biotehnology from a reputed university. I have used tools like expasy etc for my research work. i have published scientific articles in international journals.